Sign In | Join Free | My pickjoomla.com
pickjoomla.com
Products
Search by Category
Home > Chemicals > Explosive >

Steroid Injections For Carpal Tunnel

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    steroid injections for carpal tunnel

    All steroid injections for carpal tunnel wholesalers & steroid injections for carpal tunnel manufacturers come from members. We doesn't provide steroid injections for carpal tunnel products or service, please contact them directly and verify their companies info carefully.

    Total 97 products from steroid injections for carpal tunnel Manufactures & Suppliers
    Buy cheap  product

    Brand Name:KANGDISEN

    Model Number:10 IU

    Place of Origin:China

    ...OEM Somatropin Injection Anabolic Steroids Growth Hormone 10 IU unlabelled We can supplly HGH 10 IU/vial, unlabelled as the ...

    Hongkong Kangdisen Medical Co., Limited
    Verified Supplier

    Hong Kong

    Buy cheap  product

    Brand Name:SR Health Tech

    Model Number:12629-01-5

    Place of Origin:China

    ...Injectable Steroids 99% Purity Human Growth Hormone, HGH White Lyophilized Powder Muscle Building Steroids CAS No. 12629-01-5 Profile: Human growth hormone is a remarkable hormone. It is secreted by ...

    Steroidraws Health Tech Company Limited
    Verified Supplier

    Hong Kong

    Buy cheap  product

    Brand Name:www.steroidaily.com

    Model Number:service01@chembj.com

    Place of Origin:china manufactuer

    ...99% Purity Weight Loss Steroids Peptide Human Growth Fragment 176-191 2mg / Vial HGH fragment 176-191 Synonyms: Fragment 176-...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Buy cheap  product

    Brand Name:LSW

    Model Number:10mg/vials,10vials/kit

    Place of Origin:China

    ...HGH Fragment 176-191 Fat Burning Steroids White Powder 2mg / vials 99% Min Assay HGH Frag 176-191 is a fragment of the ...

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier

    Hong Kong

    Buy cheap  product

    Brand Name:GB

    Place of Origin:China

    ...12629-01-5 Human Growth Hormone Steroid Bodybuilding Somatropin 191aa Human growth hormone: Up close and personal 1. Growth hormone (GH) is a small ...

    Hubei God bull Pharmaceutical Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap  product

    Brand Name:wumeitech

    Model Number:SARMs Powder

    Place of Origin:China

    ...Pharmaceutical Grade Steroids Health Care Supplement Vitamin B12 Cyanocobalamin VB12 Vitamin B12 Detail: Vitamin B12 (Cyanocobalamin) Synonyms: Rubramin ...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Buy cheap  product

    Brand Name:JCJ

    Model Number:CAS: 86168-78-7

    Place of Origin:China

    ...Peptides Steroids HGH Fragment 176-191 2mg/vial Fat Loss No side Effect HGH fragment 176-191 ...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Buy cheap  product

    Brand Name:Gear steroids

    Model Number:1045-69-8

    Place of Origin:China

    ...GMP Certified Peptide Steroid Hormones Cjc 1295 with Dac Raw Hormone Powders CJC-1295 Peptide Profile CJC-1295 is an injectable peptide used to increase GH production. This peptide is a growth hormone...

    Shanghai Rong Can Science And Technology Co., Ltd.
    Verified Supplier

    Shanghai

    Buy cheap  product

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    ... Growth Hormone CJC 1295 W/O DAC Fat Loss 1. What is CJC 1295 CJC 1295 is an injectable peptide used to increase GH production. This peptide is a growth hormone releasing hormone (GHRH) mimetic...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Buy cheap  product

    Brand Name:HKYC

    Model Number:66004-57-7

    Place of Origin:China

    ...Fat Loss Steroids Fragment 176-191 2mg Soluble In Water Or Acetic Acid Email: ycgsales06@ycphar.com WhatsApp: ...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Buy cheap  product

    Brand Name:Pharmlab

    Model Number:Anabolic steroids

    Place of Origin:China

    Anabolic Steroids About How These Drugs Work And How They Can Affect Your Health >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> Performance-enhancing drugs: Know the risks Are you hoping to gain a competitive edge

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap  product

    Brand Name:JNJG

    Model Number:Cjc1295

    Place of Origin:CHINA

    Lab Supply Peptides Cjc-1295 Without DAC 2mg/Vial Powder For Bodybuilding Cjc-1295 Specification: Product Name Cjc1295 Cjc1295 Alias CJC1295 Without DAC Cjc1295 CAS 863288-34-0 Cjc1295 Molecular Formula C165H271N47O46 Cjc1295 Molecular weight 3649.30 ...

    Jinan  Jiage  Biological Technology Co.,Ltd
    Verified Supplier

    Shandong

    Buy cheap  product

    Brand Name:NJBN STEROID

    Model Number:863288-34-0

    Place of Origin:MADE IN CHINA

    Hot Sell Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production Quick Detail: Product Name CJC1295 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-...

    Nanjing Bangnuo Biotechnology Co., Ltd
    Verified Supplier

    Jiangsu

    Buy cheap  product

    Brand Name:HKB

    Model Number:221231-10-3

    Place of Origin:China

    Safety Peptide Fragment Human Growth Hormone HGH 176 - 191 2Mg / vial Product Name: Frag 176 191 Synonyms: GH Fragment 176-191, AOD-9604 CAS : 221231-10-3 Purity : 98% min Molecular formula: C78H123N23O23S2 MW : 1815.08152 Appearance: White Powder Grade :...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Buy cheap  product

    Brand Name:Biofriend

    Model Number:863288-34-0

    Place of Origin:China

    Effective CJC-1295 Acetate Human Growth Hormone Peptide Bodybuilding 99% purity 863288-34-0 Quick Detail : Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu...

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap  product

    Brand Name:Huao

    Model Number:8024-22-4

    Place of Origin:China

    CAS 8024-22-4 Pharmaceutica Raw Materials , Vitis Vinifera Grape Seed Oil Organic Solvents for Food Contact: Snow Deng/International Sales Manager Skype:snoww527 E-mail/Facebook:snow@yccreate.com WhatsApp,Wechat:(86)18826127640 www.anabolic-steroidpowder....

    Guangzhou Huao Chemical Co.,Ltd
    Verified Supplier

    Guangdong

    Buy cheap  product

    Brand Name:YIHAN

    Model Number:Jintropin

    Place of Origin:China

    BodyBuilding Human Growth Hormone Peptide HGH Authentic Jintropin Kigtropin 10IU / Vial Quick Details: Product name: Jintropin Assay: 98% Packaging Standard: Jintropin (10 iu / vial; 10 vials / kit) Type: Vitamins, Amino Acids and Coenzymes Grade Standard...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Buy cheap  product

    Brand Name:HONGKONG YUANCHENG

    Model Number:SUPPLEMENT AND VITAMIN

    Place of Origin:CHINA

    Safe Health Care Supplement Vitamin B12(Cyanocobalamin) VB12 Food and Feed Grade Vitamin B12 Detail: Vitamin B12 (Cyanocobalamin) Synonyms: Rubramin PC; Dodex; Betaline-12; Cotel; Byladoce; Depinar; Anacobin; Betalin 12, crystalline; Cyanobalamin ...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Buy cheap  product

    Brand Name:Hygene Biopharm

    Model Number:Hygetropin 8iu

    Place of Origin:China

    ...Recombinant human growth hormone for Injection hygetropin black tops vs yellow top hygiene hyge hgh Q1: yellow top hyges vs. black ...

    Marvel Pharma Inc.
    Active Member

    Hunan

    Buy cheap  product

    Brand Name:HKGC

    Model Number:66004-57-7

    Place of Origin:China

    Specification: Product Name: HGH Fragment 176-191 Unit size: 5 mg/vial CAS NO.: 66004-57-7 Synonyms: HGH FRAG 176-191, frag 176 Sequence: H-Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe-OH Purity: ≥98% (HPLC) Physical State: ...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Active Member

    Hong Kong

    Inquiry Cart 0